PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g08100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family Whirly
Protein Properties Length: 237aa    MW: 26329.2 Da    PI: 10.2912
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g08100genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly201.11.4e-62601981139
      Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePl 99 
                 sv+k+kaal+ ++++ptf+++dsg +kl+r+G ++l++ ++++erkydWek+q falsatev++l+++++k+sceffhdp++++sn+G+vrk+l+++  
  CA10g08100  60 SVFKGKAALSAEPRLPTFNKMDSGVVKLNRRGVIMLTFWPSIGERKYDWEKRQLFALSATEVGSLISMGTKDSCEFFHDPSMQSSNAGQVRKSLSIKSN 158
                 79************************************************************************************************* PP

      Whirly 100 pdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                 +dG+G+fv+lsv n+ +k+n++f+vPv+ aefav+r++++
  CA10g08100 159 ADGTGYFVSLSVVNNNLKTNDRFTVPVTTAEFAVMRTAFS 198
                 *************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.104.1E-7548215IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544476.36E-6553228IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.9E-5961195IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MKFFSLHNRN QLLLNKLPVE GVKDSIWQHA INTFAGFSSV RQYGAADAGK LAGRVFAPYS  60
VFKGKAALSA EPRLPTFNKM DSGVVKLNRR GVIMLTFWPS IGERKYDWEK RQLFALSATE  120
VGSLISMGTK DSCEFFHDPS MQSSNAGQVR KSLSIKSNAD GTGYFVSLSV VNNNLKTNDR  180
FTVPVTTAEF AVMRTAFSFA LPHIMGWDRF TNRPSECISQ SPAKVVPQLT EVEWCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A1e-115462162172StWhy2
3n1i_A1e-115462162172protein StWhy2
3n1j_A1e-115462162172Protein StWhy2
3n1k_A1e-115462162172protein StWhy2
3n1l_A1e-115462162172protein StWhy2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM2345040.0HM234504.1 Solanum tuberosum Why2 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016545756.11e-173PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X1
SwissprotD9J0341e-151WHY2_SOLTU; Single-stranded DNA-bindig protein WHY2, mitochondrial
TrEMBLK4D8E01e-148K4D8E0_SOLLC; Uncharacterized protein
STRINGSolyc11g044750.1.11e-148(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97822228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.18e-95WHIRLY 2